Teriparatide acetate

Teriparatide acetate

Product Name: Teriparatide acetate Synonyms: PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF CAS: 52232-67-4 MF: C172H278N52O47S2 MW: 3890.49792 EINECS: Product Categories: Amino Acid Derivatives;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;EndocrinologyandHormones;proteins Mol File: 52232-67-4.mol Usage: A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH.

This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

Our advantage:

1. Rich experience.

We specialize in this field for many years, our steroids and hormones exported to Overseas, to Europe, Africa, Asia and Americas and so on other country, and we have got very good feedback from our customers, and had Established long friendly relations of cooperation.

2. Great quality, purity and favourable.

Good quality is one of our secret success, welcome order the samples, MOQ just 10 grams.

3. Safest and fastest delivery.

We have Adequate stock, and can delivery quickly at the very day when receive the payment.

We have special way could ship 0.01 kilo to 3.5 kilo products a time. We offer melting powder into liquid service. And ship the liquid in special bottles.

4. Good after-sales service.

Tell the package update ASAP, and will try best solve when customer encountered various.